PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01048.1_g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 94aa    MW: 11265.3 Da    PI: 4.3635
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01048.1_g00010.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM51.82.7e-164994248
                      NAM  2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48
                             +pGfrFhPt+eel+ +yL++kvegk++++ e i+ +d+y+++Pw+Lp
  Rsa1.0_01048.1_g00010.1 49 MPGFRFHPTEEELIEFYLRRKVEGKRFNV-ELITFLDLYRYDPWELP 94
                             79***************************.89**************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.01E-164794IPR003441NAC domain
PROSITE profilePS5100520.3534894IPR003441NAC domain
PfamPF023659.1E-85091IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 94 aa     Download sequence    Send to blast
MVSSTTSTIT MSNQVNNDSE KCIEEDGYRH ENHAQNDDEA DDHDHEKIMP GFRFHPTEEE  60
LIEFYLRRKV EGKRFNVELI TFLDLYRYDP WELP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-143994661Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1894521e-112AC189452.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB072E02, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009114197.12e-40PREDICTED: NAC domain-containing protein 72-like
SwissprotQ9SK554e-18NAC42_ARATH; Transcription factor JUNGBRUNNEN 1
SwissprotQ9ZVH09e-18FEZ_ARATH; Protein FEZ
TrEMBLM4DLN58e-43M4DLN5_BRARP; Uncharacterized protein
STRINGBra017416.1-P2e-42(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79671340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.15e-35NAC domain containing protein 35